PDCD6/ALG2 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 85792-3-PBS

  Biolayer interferometry (BLl) kinetic assays of 85792-3-PBS against Human PDCD6/ALG2 were performed. The affinity constant is 3.63 nM.

PDCD6/ALG2 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 85792-3-PBS

Clone No.250087C5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

ALG2, PDCD6, ALG 2, ALG-2, Apoptosis-linked gene 2 protein homolog

---

Product Information

85792-3-PBS targets PDCD6/ALG2 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2949

  Product name: Recombinant human PDCD6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-191 aa of BC012384

  Sequence: MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV

• Full Name: programmed cell death 6
• Calculated Molecular Weight: 191 aa, 22 kDa
• GenBank Accession Number: BC012384
• Gene Symbol: PDCD6
• Gene ID (NCBI): 10016
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75340
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.