PDCD7 Polyclonal antibody

• 

  WB analysis of HeLa using 12485-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12485-1-AP (PDCD7 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 12485-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12485-1-AP (PDCD7 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 12485-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12485-1-AP (PDCD7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

PDCD7 Polyclonal Antibody for WB, ELISA

Cat No. 12485-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

ES18, HES18, PDCD7, programmed cell death 7

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

12485-1-AP targets PDCD7 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3175

  Product name: Recombinant human PDCD7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 340-485 aa of BC016992

  Sequence: PPASADETFTHHLQRLRKLIKKRSELYEAEERALRVMLEGEQEEERKRELEKKQRKEKEKILLQKREIESKLFGDPDEFPLAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWATAVKLH

• Full Name: programmed cell death 7
• Calculated Molecular Weight: 485 aa, 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC016992
• Gene Symbol: PDCD7
• Gene ID (NCBI): 10081
• RRID: AB_2162745
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N8D1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nucleic Acids Res; Distinct functions for the paralogous RBM41 and U11/U12-65K proteins in the minor spliceosome; Authors - Antto J Norppa
rat	WB	Drug Des Devel Ther; Notch inhibitor can attenuate apparent diffusion coefficient and improve neurological function through downregulating NOX2-ROS in severe traumatic brain injury.; Authors - Hong-Mei Zhang