PDCD7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PDCD7 Polyclonal antibody (12485-1-AP)

PDCD7 Polyclonal Antibody for WB, ELISA

Cat No. 12485-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

ES18, HES18, PDCD7, programmed cell death 7

• 

  WB analysis of HeLa using 12485-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12485-1-AP (PDCD7 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 12485-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12485-1-AP (PDCD7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 12485-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12485-1-AP (PDCD7 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PDCD7 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12485-1-AP targets PDCD7 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3175

  Product name: Recombinant human PDCD7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 340-485 aa of BC016992

  Sequence: PPASADETFTHHLQRLRKLIKKRSELYEAEERALRVMLEGEQEEERKRELEKKQRKEKEKILLQKREIESKLFGDPDEFPLAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWATAVKLH

• Full Name: programmed cell death 7
• Calculated Molecular Weight: 485 aa, 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC016992
• Gene Symbol: PDCD7
• Gene ID (NCBI): 10081
• RRID: AB_2162745
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N8D1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The PDCD7 Polyclonal antibody (Cat# 12485-1-AP) has 2 citations. One appears in Nucleic Acids Research (2024), studying paralogous RBM41 and U11/U12-65K proteins in the minor spliceosome, reflecting RNA biology research. The other is in Drug Design, Development and Therapy (2018), investigating Notch inhibition and NOX2-ROS downregulation in severe traumatic brain injury, representing neurology and drug development research. Both citations used the antibody for Western blot applications in human and rat samples, respectively.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nucleic Acids Res; Distinct functions for the paralogous RBM41 and U11/U12-65K proteins in the minor spliceosome; Authors - Antto J Norppa
rat	WB	Drug Des Devel Ther; Notch inhibitor can attenuate apparent diffusion coefficient and improve neurological function through downregulating NOX2-ROS in severe traumatic brain injury.; Authors - Hong-Mei Zhang