PDCL2 Polyclonal antibody

PDCL2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17407-1-AP

Publications (4)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

GCPHLP, PDCL2, phosducin like 2, Phosducin like protein 2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 17407-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 17407-1-AP (PDCL2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse testis using 17407-1-AP
mouse testis tissue were subjected to SDS PAGE followed by western blot with 17407-1-AP (PDCL2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 17407-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 17407-1-AP (PDCL2 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 17407-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 17407-1-AP (PDCL2 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human testis using 17407-1-AP
Immunohistochemical analysis of paraffin-embedded human testis using 17407-1-AP (PDCL2 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human testis using 17407-1-AP
Immunohistochemical analysis of paraffin-embedded human testis using 17407-1-AP (PDCL2 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human spleen using 17407-1-AP
Immunohistochemical analysis of paraffin-embedded human spleen using 17407-1-AP (PDCL2 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human spleen using 17407-1-AP
Immunohistochemical analysis of paraffin-embedded human spleen using 17407-1-AP (PDCL2 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary using 17407-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary using 17407-1-AP (PDCL2 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary using 17407-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary using 17407-1-AP (PDCL2 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PDCL2 in ?

Overview

Tested Applications
Product Information
Publications (4)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse testis tissue, rat testis tissue
Positive IHC detected in	human kidney tissue, human ovary tissue, human spleen tissue, human testis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:4000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17407-1-AP targets PDCL2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag11427 Product name: Recombinant human PDCL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-250 aa of BC034431 Sequence: MQDPNEDTEWNDILRDFGILPPKEESKDEIEEMVLRLQKEAMVKPFEKMTLAQLKEAEDEFNEEDMQAVETYRKKRLQEWKALKKKQKFGELREISGNQYVNEVTNAEEDVWVIIHLYRSSIPMCLLVNQHLSLLARKFPETKFVKAIVNSCIQHYHDNCLPTIFVYKNGQIEAKFIGIIECGGINLKLEELEWKLAEVGAIQTDLEENPRKDMVDMMVSSIRNTSIHDDSDSSNSDNEPNREKYSINSF Predict reactive species
Full Name	phosducin-like 2
Calculated Molecular Weight	250 aa, 29 kDa
Observed Molecular Weight	30-35 kDa
GenBank Accession Number	BC034431
Gene Symbol	PDCL2
Gene ID (NCBI)	132954
RRID	AB_2299492
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8N4E4
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for PDCL2 antibody 17407-1-AP	Download protocol
WB protocol for PDCL2 antibody 17407-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The PDCL2 Polyclonal antibody (Cat# 17407-1-AP) has 4 citations. These appear in Ecotoxicology and Environmental Safety, PNAS Nexus, Andrology, and Translational Andrology and Urology. The research fields span sperm head morphology, acrosome formation, male fertility, reproductive toxicology (PFOA exposure), and Sertoli cell biology in both mouse and human contexts.

Species	Application	Title
mouse	WB	Ecotoxicol Environ Saf PFOA exposure decreases acrosome reaction and increases DNA oxidative damage by impairing the sperm head shaping in mice. Authors - Chuan Wang View Article
mouse	WB	PNAS Nexus Tex46 knockout male mice are sterile secondary to sperm head malformations and failure to penetrate through the zona pellucida Authors - Yoshitaka Fujihara View Article
mouse	WB,IF	Andrology PDCL2 is essential for sperm acrosome formation and male fertility in mice Authors - Yoshitaka Fujihara View Article
human	IHC	Transl Androl Urol Identification of PDCL2 as a candidate marker in Sertoli cell-only syndrome by chromatin immunoprecipitation-sequencing and bioinformatics analysis Authors - Yu Yang View Article