PDE1B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PDE1B Polyclonal antibody, PBS Only (13121-1-PBS)

• 

  WB analysis using 13121-1-AP (same clone as 13121-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13121-1-AP (PDE1B antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13121-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 13121-1-AP (same clone as 13121-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13121-1-AP (PDE1B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13121-1-PBS in a different storage buffer formulation.

PDE1B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13121-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13121-1-PBS targets PDE1B in WB, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3817

  Product name: Recombinant human PDE1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 187-536 aa of BC032226

  Sequence: LLTRHNLISRFKIPTVFLMSFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKSECAIVYNDRSVLENHHISSVFRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKPKALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQSQIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD

• Full Name: phosphodiesterase 1B, calmodulin-dependent
• Calculated Molecular Weight: 536 aa, 61 kDa
• Observed Molecular Weight: 61 kDa
• GenBank Accession Number: BC032226
• Gene Symbol: PDE1B
• Gene ID (NCBI): 5153
• RRID: AB_3085407
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q01064
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PDE1B, also known as PDES1B, belongs to the cyclic nucleotide phosphodiesterase family and PDE1 subfamily. PDE1B degrades cAMP and cGMP and regulates various important physiological processes such as proliferation and lipogenesis (PMID: 21960012). PDE1B is enriched in brain tissue. PDE1B gene consists of two isoforms, PDE1B1 (encoding 61 kDa protein with 536 amino acid residues) and PDE1B2 (encoding 59 kDa protein containing 516 amino acid residues).