Tested Applications
| Positive WB detected in | HeLa cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31730-1-AP targets PDE4B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag35552 Product name: Recombinant human PDE4B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 651-736 aa of BC105040 Sequence: WYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT Predict reactive species |
| Full Name | phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) |
| Calculated Molecular Weight | 736 aa, 83 kDa |
| Observed Molecular Weight | 83 kDa |
| GenBank Accession Number | BC105040 |
| Gene Symbol | PDE4B |
| Gene ID (NCBI) | 5142 |
| RRID | AB_3670101 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q07343 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PDE4B, also known as DPDE4, is a member of the PDE family of type IV cAMP-specific cyclic nucleotides. PDE4B regulates the cellular concentration of cyclic nucleotides and thus plays a role in signal transduction of inflammatory factors. Among all subtypes of PDE4, PDE4B is closely associated with cancer and has a major contribution to the role in hematological malignancies. PDE4B is distributed in multiple tissues, especially myeloid cells (PMID: 35899614, PMID: 36278172).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PDE4B antibody 31730-1-AP | Download protocol |
| WB protocol for PDE4B antibody 31730-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PDE4B Polyclonal antibody (Cat# 31730-1-AP) has 1 total citation. It was cited in a study published in International Journal of Surgery (IF: 9), which investigated how polyethylene terephthalate microplastics exposure increases ulcerative colitis risk through multiomics integration, machine learning, and molecular docking. The research field encompasses environmental toxicology and gastrointestinal pathology. The antibody was used in Western Blot with mouse samples.
| Species | Application | Title |
|---|---|---|
Int J Surg Polyethylene terephthalate microplastics exposure enhances the risk of ulcerative colitis: insights from multiomics integration, machine learning, and molecular docking reveal intestinal toxicity mechanisms. |
