PDE4DIP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PDE4DIP Polyclonal antibody, PBS Only (12637-1-PBS)

• 

  WB analysis using 12637-1-AP (same clone as 12637-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12637-1-AP (PDE4DIP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12637-1-PBS in a different storage buffer formulation.

PDE4DIP Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12637-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Cardiomyopathy-associated protein 2, CMYA2, KIAA0454, KIAA0477, MMGL

---

Product Information

12637-1-PBS targets PDE4DIP in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3332

  Product name: Recombinant human PDE4DIP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-310 aa of BC025406

  Sequence: MKGTDSGSCCRRRCDFGCCCRASRRAHYTPYRSGDATRTPQSPRQTPSRERRRPEPAGSWAAAAEEEEAAAAATPWMRDYFAEDDGEMVPRTSHTAAFLSDTKDRGPPVQSQIWRSGEKVPFVQTYSLRAFEKPPQVQTQALRDFEKHLNDLKKENFSLKLRIYFLEERMQQKYEASREDIYKRNTELKVEVESLKRELQDKKQHLDKTWADVENLNSQNEAELRRQFEERQQETEHVYELLENKMQLLQEESRLAKNEAARMAALVEAEKECNLELSEKLKGVTKNWEDVPGDQVKPDQYTEALAQRDK

• Full Name: phosphodiesterase 4D interacting protein
• Calculated Molecular Weight: 310 aa, 36 kDa
• Observed Molecular Weight: 250-270 kDa
• GenBank Accession Number: BC025406
• Gene Symbol: PDE4DIP
• Gene ID (NCBI): 9659
• RRID: AB_3741833
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VU43
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.