PDE5A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PDE5A Polyclonal antibody (22624-1-AP)

PDE5A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 22624-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CGB PDE, CN5A, PDE5, PDE5A, PDE5A1, phosphodiesterase 5A, cGMP

• 

  WB analysis using 22624-1-AP

  mouse lung lysates were subjected to SDS PAGE followed by western blot with 22624-1-AP (PDE5A antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 22624-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 22624-1-AP (PDE5A Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 22624-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 22624-1-AP (PDE5A Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 22624-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 22624-1-AP (PDE5A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 22624-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 22624-1-AP (PDE5A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SKOV-3 using 22624-1-AP

  Immunofluorescent analysis of SKOV-3 cells using 22624-1-AP (PDE5A antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PDE5A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse lung tissue
• Positive IHC detected in: human ovary tumor tissue, human thyroid cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SKOV-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22624-1-AP targets PDE5A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rabbit, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18779

  Product name: Recombinant human PDE5A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 321-482 aa of BC126233

  Sequence: ETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGKVK

• Full Name: phosphodiesterase 5A, cGMP-specific
• Calculated Molecular Weight: 875 aa, 100 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC126233
• Gene Symbol: PDE5A
• Gene ID (NCBI): 8654
• RRID: AB_2879137
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O76074
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDE5A (cGMP-binding cGMP-specific phosphodiesterase) plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase catalyzes the specific hydrolysis of cGMP to 5'-GMP. Through alternative splicing, the PDE5A gene produces three proteins (PDE5A1, PDE5A2, and PDE5A3) that differ in their N termini and range in mass from 89 to 105 kDa. (PMID: 25704994; 21215707). A second 70 kDa band was consistently observed in heart tissue that either reflected a splice variant or proteolytic fragment of PDE5A. (PMID: 15576651).

Publications

What published studies show

The PDE5A Polyclonal antibody (Cat# 22624-1-AP) has 12 citations spanning 11 journals, including J Exp Clin Cancer Res, Cancer Res, Int J Mol Sci, Sci Rep, iScience, Front Cell Dev Biol, J Ethnopharmacol, Am J Respir Cell Mol Biol, Am J Physiol Gastrointest Liver Physiol, Acta Histochem, and PeerJ. Research fields cover oncology (esophageal, bladder, urothelial cancers, metastasis), cardiovascular disease (hypertrophy, cardiomyopathy, pulmonary hypertension), cGMP/PKG signaling, calcium homeostasis, and angiogenesis.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Exp Clin Cancer Res; CircPDE5A-encoded novel regulator of the PI3K/AKT pathway inhibits esophageal squamous cell carcinoma progression by promoting USP14-mediated de-ubiquitination of PIK3IP1; Authors - Kai Lei
mouse	WB	J Ethnopharmacol; Zhenwu decoction ameliorates cardiac hypertrophy through activating sGC (soluble guanylate cyclase) - cGMP (cyclic guanosine monophosphate) - PKG (protein kinase G) pathway; Authors - Liqian Chen
mouse	WB	Int J Mol Sci; Protective Effect of Paeoniae Radix Alba Carbonisata on Hepatic Amyloidosis by Regulating Calcium Homeostasis.; Authors - Gangqiang Liu
	IF	Am J Respir Cell Mol Biol; Decreased Cyclic GMP-protein Kinase G signaling impairs Angiogenesis in a Lamb Model of Persistent Pulmonary Hypertension of Newborn.; Authors - Megha Sharma
bovine	WB	Front Cell Dev Biol; Myostatin Mutation Promotes Glycolysis by Increasing Phosphorylation of Phosphofructokinase via Activation of PDE5A-cGMP-PKG in Cattle Heart.; Authors - Mingjuan Gu
mouse	WB,IHC	Front Cell Dev Biol; An MRTF-A-Sp1-PDE5 Axis Mediates Angiotensin-II-Induced Cardiomyocyte Hypertrophy.; Authors - Teng Wu