PDE5A Recombinant monoclonal antibody

PDE5A Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 85030-5-RR
Clone No.242597D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), ELISA

CGB-PDE, cGMP-binding cGMP-specific phosphodiesterase, cGMP-specific 3',5'-cyclic phosphodiesterase, CN5A, EC:3.1.4.35

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, mouse lung tissue, U-251 cells
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85030-5-RR targets PDE5A in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18779

Product name: Recombinant human PDE5A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 321-482 aa of BC126233

Sequence: ETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGKVK

Predict reactive species
Full Name phosphodiesterase 5A, cGMP-specific
Calculated Molecular Weight 875 aa, 100 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC126233
Gene Symbol PDE5A
Gene ID (NCBI) 8654
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO76074
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDE5A (cGMP-binding cGMP-specific phosphodiesterase) plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase catalyzes the specific hydrolysis of cGMP to 5'-GMP. Through alternative splicing, the PDE5A gene produces three proteins (PDE5A1, PDE5A2, and PDE5A3) that differ in their N termini and range in mass from 89 to 105 kDa. (PMID: 25704994; 21215707). A second 70 kDa band was consistently observed in heart tissue that either reflected a splice variant or proteolytic fragment of PDE5A. (PMID: 15576651).

Protocols

Product Specific Protocols
FC protocol for PDE5A antibody 85030-5-RRDownload protocol
WB protocol for PDE5A antibody 85030-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...