PDE6B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PDE6B Polyclonal antibody (10353-1-AP)

PDE6B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10353-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

EC:3.1.4.35, GMP PDE beta, GMP-PDE beta, PDEB, Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta

• 

  WB analysis using 10353-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10353-1-AP (PDE6B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse eye using 10353-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 10353-1-AP (PDE6B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse eye using 10353-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 10353-1-AP (PDE6B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PDE6B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse eye tissue, rat eye tissue
• Positive IHC detected in: mouse eye tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10353-1-AP targets PDE6B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0365

  Product name: Recombinant human PDE6B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 198-428 aa of BC000249

  Sequence: GPFFTSEDEDVFLKYLNFATLYLKIYHLSYLHNCETRRGQVLLWSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDMTKEKEFFDVWSVLMGESQPYSGPRTPDGREIVFYKVIDYILHGKEEIKVIPTPSADHWALASGLPSYVAESGFICNIMNASADEMFKFQEGALDDSGWLIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLMESLTQFLGWS

• Full Name: phosphodiesterase 6B, cGMP-specific, rod, beta
• Calculated Molecular Weight: 98 kDa
• Observed Molecular Weight: 98 kDa
• GenBank Accession Number: BC000249
• Gene Symbol: PDE6B
• Gene ID (NCBI): 5158
• RRID: AB_2161431
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35913
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDE6 is a cGMP-specific PDE family and presents multicomponent enzyme complexes. The rod PDE6 enzyme is comprised of two catalytic subunits (PDE6A and PDE6B) and it is expressed in human lungs(PMID:20979602). PDE6B(Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta) is also named as PDEB and belongs to the cyclic nucleotide phosphodiesterase family. PDE6B also has a C-terminal CAAX motif for posttranslational processing involving lipidation, proteolysis, and carboxymethylation (PMID:8394243). Defects in PDE6B are the cause of retinitis pigmentosa type 40 (RP40)(PMID:22334370) and congenital stationary night blindness autosomal dominant type 2 (CSNBAD2)(PMID:8075643).

Publications

What published studies show

The PDE6B Polyclonal antibody (Cat# 10353-1-AP) has 1 total citation. It appears in Respiratory Research (Impact Factor 5.7), published in 2010. The cited study investigated PDE6 subunit expression and alterations in idiopathic pulmonary fibrosis using IHC on human samples. The associated research field is pulmonary fibrosis/respiratory disease.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Respir Res; Phosphodiesterase 6 subunits are expressed and altered in idiopathic pulmonary fibrosis.; Authors - Nikolova Sevdalina S