Product Information
83214-2-PBS targets PDGF-BB as part of a matched antibody pair:
MP00198-1: 83214-2-PBS capture and 83214-3-PBS detection (validated in Cytometric bead array)
MP00198-3: 83214-1-PBS capture and 83214-2-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Affinity | KD=2.39 x 10-10M KOff=3.97 x 10-5M KOn=1.66 x 105M |
| Immunogen |
CatNo: Ag25986 Product name: Recombinant human PDGFB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC029822 Sequence: MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIA Predict reactive species |
| Full Name | platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) |
| Calculated Molecular Weight | 241 aa, 27 kDa |
| GenBank Accession Number | BC029822 |
| Gene Symbol | PDGFB |
| Gene ID (NCBI) | 5155 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P01127-1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
