PDGF-BB Recombinant monoclonal antibody, PBS Only (Capture)

PDGF-BB Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83214-4-PBS
Clone No.230486G11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

PDGFB, PDGFbb, Becaplermin, PDGF 2, PDGF subunit B

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83214-4-PBS targets PDGF-BB as part of a matched antibody pair:

MP00198-2: 83214-4-PBS capture and 83214-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Affinity
KD=1.16 x 10-9M
KOff=1.97 x 10-4M
KOn=1.70 x 105M
Immunogen

CatNo: Ag25986

Product name: Recombinant human PDGFB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-95 aa of BC029822

Sequence: MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIA

Predict reactive species
Full Name platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
Calculated Molecular Weight 241 aa, 27 kDa
GenBank Accession NumberBC029822
Gene Symbol PDGFB
Gene ID (NCBI) 5155
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01127-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...