PDHA2 Polyclonal antibody

• 

  WB analysis using 17134-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17134-1-AP (PDHA2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 17134-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 17134-1-AP (PDHA2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 17134-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 17134-1-AP (PDHA2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PDHA2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17134-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

PDHA2, PDHAL, PDHE1 A type II

---

Tested Applications

• Positive WB detected in: A431 cells, human placenta tissue, mouse testis tissue, rat testis tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

17134-1-AP targets PDHA2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10882

  Product name: Recombinant human PDHA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-388 aa of BC030697

  Sequence: MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGLKYYRMMLTVRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQFATTDPEPHLEELGHHIYSSDSSFEVRGANPWIKFKSVS

• Full Name: pyruvate dehydrogenase (lipoamide) alpha 2
• Calculated Molecular Weight: 388 aa, 43 kDa
• Observed Molecular Weight: 40-43 kDa
• GenBank Accession Number: BC030697
• Gene Symbol: PDHA2
• Gene ID (NCBI): 5161
• RRID: AB_2878352
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29803
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Death Dis; TMEM232 is required for the formation of sperm flagellum and male fertility in mice; Authors - Xinying Cai