PDHX Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PDHX Polyclonal antibody (10951-1-AP)

• Featured Product
• KD/KO Validated

PDHX Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 10951-1-AP Copied!

Publications (20)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

PDX1, pyruvate dehydrogenase complex, component X, Lipoyl-containing pyruvate dehydrogenase complex component X, E3-binding protein, E3 binding protein

• 

  WB analysis using 10951-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10951-1-AP (PDHX antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10951-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10951-1-AP (PDHX antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SKOV-3 using 10951-1-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 10951-1-AP (PDHX antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10951-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10951-1-AP (PDHX antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 10951-1-AP

  IP result of anti-PDHX (IP:10951-1-AP, 4ug; Detection:10951-1-AP 1:5000) with HEK-293 cells lysate 2000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10951-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 10951-1-AP (PDHX antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PDHX in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, HEK-293 cells, SKOV-3 cells, HepG2 cells, NIH/3T3 cells, mouse kidney tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10951-1-AP targets PDHX in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1389

  Product name: Recombinant human PDHX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-501 aa of BC010389

  Sequence: MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATVKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRLA

• Full Name: pyruvate dehydrogenase complex, component X
• Calculated Molecular Weight: 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC010389
• Gene Symbol: PDHX
• Gene ID (NCBI): 8050
• RRID: AB_2163102
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00330
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDHX (Pyruvate dehydrogenase protein X component), an E3-binding protein in the PDC, is acetylated by the p300 at Lys 488, impeding the interaction between PDHX and dihydrolipoyl transacetylase (E2), thereby disrupting PDC assembly to inhibit its activation (PMID: 30012170). PDHX was characterized as a metabolically essential gene for esophageal squamous cell carcinoma (ESCC), and knockdown of PDHX inhibited the proliferation of cancer stem cells (CSCs) and in vivo tumor growth (PMID: 33964039). Western blot analysis detected PDHX at an apparent molecular mass of 54 kDa.

Publications

What published studies show

The 10951-1-AP PDHX Polyclonal antibody has 20 citations, appearing in journals including Nature, Cell Metabolism, Nature Chemical Biology, Cell Death & Differentiation, Cell Death & Disease, EMBO Molecular Medicine, Cell Reports, Nature Communications, and PLoS ONE. Research fields span metabolic reprogramming, cancer biology, mitochondrial function, pyruvate dehydrogenase regulation, glycolysis, and cell differentiation, with applications mainly in Western blot, IHC, IF, and co-IP.

Automatically generated from the 20 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nature; Metabolic rewiring promotes anti-inflammatory effects of glucocorticoids; Authors - Jean-Philippe Auger
human	WB,CoIP	Cell Metab; Derepressing nuclear pyruvate dehydrogenase induces therapeutic cancer cell reprogramming; Authors - Ting Zhao
human	WB	Nat Chem Biol; Mitochondria-localized MBD2c facilitates mtDNA transcription and drug resistance; Authors - Yijie Hao
		Cell Death Differ; Intestinal metabolite TMAO promotes CKD progression by stimulating macrophage M2 polarization through histone H4 lysine 12 lactylation; Authors - Youzhou Tang
human	WB	Cell Death Dis; Dihydrolipoamide dehydrogenase (DLD) is a novel molecular target of bortezomib; Authors - Yu Feng
rat	WB	Int J Biol Sci; Hypericin maintians PDX1 expression via the Erk pathway and protects islet β-cells against glucotoxicity and lipotoxicity.; Authors - Chen Liang