PDHX Recombinant monoclonal antibody

• 

  WB analysis using 87880-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87880-1-RR (PDHX antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87880-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87880-1-RR against Human PDHX were performed. The affinity constant is below 1 pM.

PDHX Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87880-1-RR

Clone No.253557E3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

PDX1, Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex, E3 binding protein, E3-binding protein, Lipoyl-containing pyruvate dehydrogenase complex component X

---

Tested Applications

• Positive WB detected in: HepG2 cells, BxPC-3 cells, HEK-293 cells, SKOV-3 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:20000-1:100000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87880-1-RR targets PDHX in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21034

  Product name: Recombinant human PDHX protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-501 aa of BC010389

  Sequence: MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATVKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRLA

• Full Name: pyruvate dehydrogenase complex, component X
• Calculated Molecular Weight: 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC010389
• Gene Symbol: PDHX
• Gene ID (NCBI): 8050
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00330
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDHX (Pyruvate dehydrogenase protein X component), an E3-binding protein in the PDC, is acetylated by the p300 at Lys 488, impeding the interaction between PDHX and dihydrolipoyl transacetylase (E2), thereby disrupting PDC assembly to inhibit its activation (PMID: 30012170). PDHX was characterized as a metabolically essential gene for esophageal squamous cell carcinoma (ESCC), and knockdown of PDHX inhibited the proliferation of cancer stem cells (CSCs) and in vivo tumor growth (PMID: 33964039). Western blot analysis detected PDHX at an apparent molecular mass of 54 kDa.