PDIA2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84765-4-RR (same clone as 84765-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84765-4-RR (PDIA2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84765-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 84765-4-RR (same clone as 84765-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 84765-4-RR (PDIA2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84765-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 84765-4-RR (same clone as 84765-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 84765-4-RR (PDIA2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84765-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84765-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84765-4-RR against Human PDIA2 were performed. The affinity constant is 24.0 pM.

PDIA2 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84765-4-PBS

Clone No.242294E10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

242294E10, PDA2, PDI, PDIP, PDIR

---

Product Information

84765-4-PBS targets PDIA2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35301

  Product name: Recombinant human PDIA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 231-390 aa of NM_006849.2

  Sequence: RADFPVDEELGLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRLVNLETTKKYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPV

• Full Name: protein disulfide isomerase family A, member 2
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: NM_006849.2
• Gene Symbol: PDIA2
• Gene ID (NCBI): 64714
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q13087
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PDIA2 (Protein disulfide-isomerase A2), a member of PDI family, is an ER protein chaperone that catalyzes the formation and breakage of disulfide bonds between cysteine residues and can inhibit aggregation of misfolded proteins by catalyzing rearrangement of -S-S- bonds in proteins. (PMID: 23486466)