Featured Product
KD/KO Validated

PDK1 Polyclonal antibody

PDK1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 18262-1-AP

Publications (83)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial, EC:2.7.11.2, PDH kinase 1, PDHK1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHC

WB analysis using 18262-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 18262-1-AP (PDK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 18262-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 18262-1-AP (PDK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 18262-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 18262-1-AP (PDK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of SiHa using 18262-1-AP
IP result of anti-PDK1 (IP:18262-1-AP, 4ug; Detection:18262-1-AP 1:3000) with SiHa cells lysate 1520 ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 18262-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 18262-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 18262-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 18262-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 18262-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 18262-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 18262-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 18262-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 18262-1-AP
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 18262-1-AP
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 18262-1-AP
Immunohistochemical analysis of paraffin-embedded human heart slide using 18262-1-AP (PDK1 Antibody) at dilution of 1:50.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 18262-1-AP
Immunohistochemical analysis of paraffin-embedded human heart slide using 18262-1-AP (PDK1 Antibody) at dilution of 1:50.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PDK1 in ?

Overview

Tested Applications
Product Information
Publications (83)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse heart tissue, HEK-293 cells, NIH/3T3 cells, mouse liver tissue, rat liver tissue
Positive IP detected in	SiHa cells
Positive IHC detected in	human liver cancer tissue, human heart tissue, human kidney tissue, human breast cancer tissue, mouse kidney tissue, rat kidney tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:6000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18262-1-AP targets PDK1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat, canine
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag13121 Product name: Recombinant human PDK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-436 aa of BC039158 Sequence: MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA Predict reactive species
Full Name	pyruvate dehydrogenase kinase, isozyme 1
Calculated Molecular Weight	436 aa, 49 kDa
Observed Molecular Weight	46-55 kDa
GenBank Accession Number	BC039158
Gene Symbol	PDK1
Gene ID (NCBI)	5163
RRID	AB_10598310
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q15118
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDK1(pyruvate dehydrogenase kinase isoform 1) is also named as PDHK1 and belongs to the PDK/BCKDK protein kinase family. It inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism (PMID:17683942). Starvation increases islet PDK activity (PMID:11723055). PDK1 has 2 isoforms with the MW of 49 and 52 kD, and a 28aa-transit-peptide in the N-terminal can be removed in the mature form. This antibody is specific to PDK1.

Protocols

Product Specific Protocols
IHC protocol for PDK1 antibody 18262-1-AP	Download protocol
IP protocol for PDK1 antibody 18262-1-AP	Download protocol
WB protocol for PDK1 antibody 18262-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The PDK1 Polyclonal antibody (Cat# 18262-1-AP) has accumulated 83 citations in journals including Nature Communications, Cell Metabolism, Molecular Cancer, Journal of Clinical Investigation, Cell Reports, FASEB Journal, Redox Biology, and Cancer Letters. Associated research fields encompass oncology (hepatocellular, breast, gastric, lung, and pancreatic cancers), metabolic reprogramming (glycolysis, TCA cycle), cardiology, neurology, immunology, diabetes, pulmonary fibrosis, liver disease, and reproductive health.

Species	Application	Title
human	WB	Mol Cancer A novel polypeptide encoded by the circular RNA ZKSCAN1 suppresses HCC via degradation of mTOR Authors - Runjie Song View Article
human	IF	Cell Metab Derepressing nuclear pyruvate dehydrogenase induces therapeutic cancer cell reprogramming Authors - Ting Zhao View Article
mouse	WB	Bioact Mater Polydopamine-mediated graphene oxide and nanohydroxyapatite-incorporated conductive scaffold with an immunomodulatory ability accelerates periodontal bone regeneration in diabetes. Authors - Yazhen Li View Article
human	WB	Nat Commun The SIAH2-NRF1 axis spatially regulates tumor microenvironment remodeling for tumor progression. Authors - Biao Ma View Article
human	WB	Nat Commun Hypoxia-induced downregulation of PGK1 crotonylation promotes tumorigenesis by coordinating glycolysis and the TCA cycle Authors - Zihao Guo View Article
mouse	WB	Nat Commun PDK4 drives abdominal aortic aneurysm by promoting smooth muscle cell metabolic reprogramming and NLRP3-mediated pyroptosis. Authors - Li Zhao View Article