Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PDLIM5 Polyclonal antibody

PDLIM5 Polyclonal Antibody for WB, IHC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, ELISA

ENH, Enigma-like PDZ and LIM domains protein, L9, PDZ and LIM domain 5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PDLIM5 in ?

Tested Applications

Positive WB detected inHUVEC cells, A549 cells, HeLa cells, NIH/3T3 cells, MCF-7 cells, MDA-MB-231 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman stomach cancer tissue, mouse heart tissue, mouse skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10530-1-AP targets PDLIM5 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0808

Product name: Recombinant human PDLIM5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 351-596 aa of BC008741

Sequence: PVGSTGVIKSPSWQRPNQGVPSTGRISNSAAYSGSVAPANSALGQTQPSDQDTLVQRAEHIPAGKRTPMCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQRKILGEVINALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICHGCEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF

Predict reactive species
Full Name PDZ and LIM domain 5
Calculated Molecular Weight 64 kDa
Observed Molecular Weight 63-68 kDa
GenBank Accession NumberBC008741
Gene Symbol PDLIM5
Gene ID (NCBI) 10611
RRIDAB_2161779
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96HC4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDLIM5 (PDZ and LIM domain 5), formerly known as enigma homolog (ENH), is a cytoplasmic protein containing PDZ domain and LIM domain at N terminus and C terminus, respectively. PDLIM5 gene generates several splicing variants, EZH1 to EZH4. The long isoform, ENH1, is widely expressed in various tissues including heart, brain, spleen, liver and kidney. In comparison, shorter isoforms that lack the LIM motifs are expressed in cardiac (ENH3) and skeletal muscle (ENH2, ENH3, and ENH4). ENH1 is essential for differentiation of striated muscles through interaction with other proteins. In addition, PDLIM5 is also involved in mood disorders, such as schizophrenia, bipolar disorder, and major depression. This antibody is specific to PDLIM5, and its specificity has been confirmed by siRNA test.

Protocols

Product Specific Protocols
IHC protocol for PDLIM5 antibody 10530-1-APDownload protocol
IP protocol for PDLIM5 antibody 10530-1-APDownload protocol
WB protocol for PDLIM5 antibody 10530-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The PDLIM5 antibody (Cat# 10530-1-AP) has 14 citations published in journals including Nature Cell Biology, Cell Death & Differentiation, Acta Pharmacologica Sinica, Oncotarget, Biomaterials Advances, Molecular Neurobiology, European Journal of Pharmaceutical Sciences, Scientific Reports, Journal of Molecular and Cellular Cardiology, Journal of Geriatric Cardiology, Chemical Biology & Drug Design, Drug Delivery, Cell Proliferation, and bioRxiv. Research fields span cancer biology (NSCLC, prostate, gastric), mechanotransduction, skin regeneration, cardiac hypertrophy, blood-brain barrier integrity, and cytoskeletal regulation.

SpeciesApplicationTitle
humanWB

Nat Cell Biol

An mRNA processing pathway suppresses metastasis by governing translational control from the nucleus

Authors - Albertas Navickas
mouseWB

Cell Death Differ

MicroRNA-17-92 regulates myoblast proliferation and differentiation by targeting the ENH1/Id1 signaling axis.

Authors - H Qiu
  • KD Validated
mouseWB,IF

Acta Pharmacol Sin

Glial growth factor 2 treatment alleviates ischemia and reperfusion-damaged integrity of the blood-brain barrier through decreasing Mfsd2a/caveolin-1-mediated transcellular and Pdlim5/YAP/TAZ-mediated paracellular permeability

Authors - Xiao-Ling Zhang
humanWB

Drug Deliv

Ultrasound-sensitive siRNA-loaded nanobubbles fabrication and antagonism in drug resistance for NSCLC.

Authors - Chunhong Su
mouseWB

Cell Prolif

Mechanotransduction Mediated by PDLIM5: The Critical Role of Serpin E2/Integrin β3-Cytoskeleton-Nucleoskeleton Axis in Mechanical Osteogenic Programming

Authors - Yuchao Yang
humanWB,IF

Biomater Adv

High performance injectable PLLA/BG composite microspheres in aging skin regeneration.

Authors - Zi Lin Li
Loading...
||
New chat

Able™

正在加载,请稍候...