PDLIM5 Monoclonal antibody, PBS Only

PDLIM5 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 67651-1-PBS
Clone No.1H9C9

Host / Isotype

Mouse / IgM

Reactivity

Human

Applications

WB, Indirect ELISA

ENH, ENH1, Enigma homolog, L9, LIM, PDLIM5, PDZ and LIM domain 5, PDZ and LIM domain protein 5

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Mouse monoclonal antibodies of IgM isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Product Information

67651-1-PBS targets PDLIM5 in WB, Indirect ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgM
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25059

Product name: Recombinant human PDLIM5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 351-596 aa of BC008741

Sequence: PVGSTGVIKSPSWQRPNQGVPSTGRISNSAAYSGSVAPANSALGQTQPSDQDTLVQRAEHIPAGKRTPMCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQRKILGEVINALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICHGCEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF

Predict reactive species
Full Name PDZ and LIM domain 5
Calculated Molecular Weight 64 kDa
Observed Molecular Weight 63-69 kDa
GenBank Accession NumberBC008741
Gene Symbol PDLIM5
Gene ID (NCBI) 10611
RRIDAB_2882850
Conjugate Unconjugated
FormLiquid
Purification MethodEuglobulin precipitation
UNIPROT IDQ96HC4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PDLIM5 (PDZ and LIM domain 5), formerly known as enigma homolog (ENH), is a cytoplasmic protein containing PDZ domain and LIM domain at N terminus and C terminus, respectively. PDLIM5 gene generates several splicing variants, EZH1 to EZH4. The long isoform, ENH1, is widely expressed in various tissues including heart, brain, spleen, liver and kidney. In comparison, shorter isoforms that lack the LIM motifs are expressed in cardiac (ENH3) and skeletal muscle (ENH2, ENH3, and ENH4). ENH1 is essential for differentiation of striated muscles through interaction with other proteins. In addition, PDLIM5 is also involved in mood disorders, such as schizophrenia, bipolar disorder, and major depression.

Loading...
||
New chat Able
正在加载,请稍候...