Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PDRG1 Polyclonal antibody

PDRG1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

C20orf126, p53 and DNA damage regulated 1, p53 and DNA damage-regulated protein 1, PDRG

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PDRG1 in ?

Tested Applications

Positive WB detected inJurkat cells
Positive IHC detected inhuman kidney tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16968-1-AP targets PDRG1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, artemia sinica
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9109

Product name: Recombinant human PDRG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-133 aa of BC009334

Sequence: MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG

Predict reactive species
Full Name p53 and DNA damage regulated 1
Calculated Molecular Weight 16 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC009334
Gene Symbol PDRG1
Gene ID (NCBI) 81572
RRIDAB_2162082
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NUG6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDRG1 codes for a novel protein called p53 and DNA damage-regulated protein 1. Human PDRG1 is predominantly expressed in normal testis and its expression can be induced by UV irradiation and be repressed by p53 [PMID14562055]. Recently, PDRG1 was identified as a novel tumor marker for multiple malignancies that is selectively regulated by genotoxic stress. Its expression was upregulated in multiple malignancies including cancers of the colon, rectum, ovary, lung, stomach, breast and uterus when compared to normal tissues [PMID: 21193842], suggesting its being a novel tumor marker that could play a role in cancer development and/or progression.

Protocols

Product Specific Protocols
WB protocol for PDRG1 antibody 16968-1-APDownload protocol
IF protocol for PDRG1 antibody 16968-1-APDownload protocol
IHC protocol for PDRG1 antibody 16968-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The PDRG1 Polyclonal antibody (Cat# 16968-1-AP) has a total of 4 citations. These appear in Cell Chem Biol, International Journal of Molecular Sciences, Annals of Translational Medicine, and DNA Repair. The associated research fields include lung cancer and PAQosome maturation, diapause embryo biology, pan-cancer prognostic analysis, and radiation response in male germline stem cells.

SpeciesApplicationTitle
humanWB

Cell Chem Biol

RUVBL1/RUVBL2 ATPase Activity Drives PAQosome Maturation, DNA Replication and Radioresistance in Lung Cancer.

Authors - Paul Yenerall
Artemia sinicaWB

Int J Mol Sci

The Potential Roles of the Apoptosis-Related Protein PDRG1 in Diapause Embryo Restarting of Artemia sinica.

Authors - Wan Zhang
humanWB

Ann Transl Med

A pan-cancer analysis of the expression and prognostic significance of PDRG1

Authors - Zhen Liu
mouseIHC

DNA Repair (Amst)

The influence of retinoic acid-induced differentiation on the radiation response of male germline stem cells.

Authors - Yi Zheng
Loading...
||
New chat

Able™

正在加载,请稍候...