• Featured Product
  • KD/KO Validated

PDS5A Polyclonal antibody

PDS5A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 17485-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, CoIP, ELISA

SCC112, SCC 112, PIG54, PDS5, KIAA0648

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, mouse kidney tissue, COLO 320 cells, Jurkat cells, K-562 cells
Positive IHC detected inhuman colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17485-1-AP targets PDS5A in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11525

Product name: Recombinant human PDS5A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-378 aa of BC009650

Sequence: VKERRAHARQCLLKNISIRREYIKQNPMATEKLLSLLPEYVVPYMIHLLAHDPDFTRSQDVDQLRDIKECLWFMLEVLMTKNENNSHAFMKKMAENIKLTRDAQSPDESKTNEKLYTVCDVALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFCNDKSYISEETRVLLLTGKPKPAGVLGAVNKPLSATGRKPYVRSTGTETGSNINVNSELNPSTGNRSREQSSEAAETGVSENEENPVRIISVTPVKNIDPVKNKEINSDQATQGNISSDRGKKRTVTAAGAENIQQKTDEKVDESGPPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEAGNAKAPKLQDLAKKAAPAERQIDLQR

Predict reactive species
Full Name PDS5, regulator of cohesion maintenance, homolog A (S. cerevisiae)
Calculated Molecular Weight 1297 aa, 147 kDa
Observed Molecular Weight 130 kDa
GenBank Accession NumberBC009650
Gene Symbol PDS5A
Gene ID (NCBI) 23244
RRIDAB_2162088
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ29RF7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for PDS5A antibody 17485-1-APDownload protocol
IHC protocol for PDS5A antibody 17485-1-APDownload protocol
WB protocol for PDS5A antibody 17485-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

EMBO J

Requirement of Nek2a and cyclin A2 for Wapl-dependent removal of cohesin from prophase chromatin

Authors - Susanne Hellmuth
humanWB

EMBO Rep

Regulation of cohesin-mediated chromosome folding by PDS5 in mammals

Authors - Dingdang Yu
mouseWB,IF,CoIP

Sci Adv

The cohesin-associated protein Pds5A governs the meiotic spindle assembly via deubiquitination of Kif5B in oocytes

Authors - Yu Zhang
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...