PDZ-GEF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PDZ-GEF2 Polyclonal antibody, PBS Only (24583-1-PBS)

• 

  WB analysis of mouse brain using 24583-1-AP (same clone as 24583-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 24583-1-AP (PDZ-GEF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24583-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 24583-1-AP (same clone as 24583-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24583-1-AP (PDZ-GEF2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24583-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 24583-1-AP (same clone as 24583-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24583-1-AP (PDZ-GEF2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24583-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 24583-1-AP (same clone as 24583-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24583-1-AP (PDZ-GEF2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24583-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 24583-1-AP (same clone as 24583-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 24583-1-AP (PDZ-GEF2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24583-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 24583-1-AP (same clone as 24583-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 24583-1-AP (PDZ-GEF2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24583-1-PBS in a different storage buffer formulation.

PDZ-GEF2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24583-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

24583-1-PBS targets PDZ-GEF2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20325

  Product name: Recombinant human PDZ-GEF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-164 aa of BC142964

  Sequence: MNSPVDPGARQALRKKPPERTPEDLNTIYSYLHGMEILSNLREHQLRLMSARARYERYSGNQVLFCSETIARCWYILLSGSVLVKGSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVENAKDNEDSILQREIPARQSRRRFRKINYKGERQTITDDVEVNSYL

• Full Name: Rap guanine nucleotide exchange factor (GEF) 6
• Calculated Molecular Weight: 1601 aa, 179 kDa
• Observed Molecular Weight: 179 kDa
• GenBank Accession Number: BC142964
• Gene Symbol: RAPGEF6
• Gene ID (NCBI): 51735
• RRID: AB_3085740
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TEU7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAPGEF6, also named PDZ-GEF2 enables several functions, including GTP-dependent protein binding activity; guanyl-nucleotide exchange factor activity; and phosphatidic acid binding activity. It is also involved in microvillus assembly; positive regulation of GTPase activity; and protein localization to plasma membrane. Located in several cellular components, including apical plasma membrane; centrosome; and endocytic vesicle.