PDZD11 Polyclonal antibody

• 

  IHC staining of mouse kidney using 26236-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26236-1-AP (PDZD11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 26236-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26236-1-AP (PDZD11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PDZD11 Polyclonal Antibody for IHC, ELISA

Cat No. 26236-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

AIPP1, PDZ domain containing 11, PDZK11, PISP

---

Tested Applications

• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26236-1-AP targets PDZD11 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23975

  Product name: Recombinant human PDZD11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 69-140 aa of BC012996

  Sequence: QLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH

• Full Name: PDZ domain containing 11
• GenBank Accession Number: BC012996
• Gene Symbol: PDZD11
• Gene ID (NCBI): 51248
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5EBL8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDZ Domain Containing 11 (PDZD11), a small protein widely expressed in the body, is mainly comprised of a single PDZ domain. PDZD11 has often been reported to be associated with the adherens junction (AJ) of epithelial cells. PDZD11 binds nectins to the cadherin-and cytoskeleton-related protein complex by interacting with PLEKHA7 to stabilize the nexins at AJs and promotes efficient early assembly of junctions.(PMID: 38766598,PMID: 35714771)