PDZD8 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PDZD8 Recombinant monoclonal antibody (87134-1-RR)

• 

  WB analysis using 87134-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87134-1-RR (PDZD8 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87134-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87134-1-RR against Human PDZD8 were performed. The affinity constant is 0.398 nM.

PDZD8 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87134-1-RR

Clone No.252321A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

PDZ domain containing 8, PDZ domain-containing protein 8, PDZK8, Sarcoma antigen NY-SAR-84/NY-SAR-104

---

Tested Applications

• Positive WB detected in: HCT 116 cells, HeLa cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87134-1-RR targets PDZD8 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21914

  Product name: Recombinant human PDZD8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 803-1154 aa of BC028375

  Sequence: HHVVTNVEKEKEPHLVEEVSVLPKEEQFVGQMGLTENKHSFQDTQFQNPTWCDYCKKKVWTKAASQCMFCAYVCHKKCQEKCLAETSVCGATDRRIDRTLKNLRLEGQETLLGLPPRVDAEASKSVNKTTGLTRHIINTSSRLLNLRQVSKTRLSEPGTDLVEPSPKHTPNTSDNEGSDTEVCGPNSPSKRGNSTGIKLVRKEGGLDDSVFIAVKEIGRDLYRGLPTEERIQKLEFMLDKLQNEIDQELEHNNSLVREEKETTDTRKKSLLSAALAKSGERLQALTLLMIHYRAGIEDIETLESLSLDQHSKKISKYTDDTEEDLDNEISQLIDSQPFSSISDDLFGPSESV

• Full Name: PDZ domain containing 8
• Calculated Molecular Weight: 1154 aa, 129 kDa
• Observed Molecular Weight: 150-160 kDa
• GenBank Accession Number: BC028375
• Gene Symbol: PDZD8
• Gene ID (NCBI): 118987
• RRID: AB_3745363
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8NEN9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDZD8 (PDZ domain containing 8) is an SMP (synaptotagmin-like mitochondrial-lipid-binding) domain-containing protein belonging to the tubular lipid-binding protein (TULIP) superfamily of lipid transfer proteins (PMID: 37961523). PDZD8 is an integral ER transmembrane protein present at ER-mitochondria contacts (PMID: 29097544). It is involved in regulating ER-mitochondria associations, mitochondrial calcium ion homeostasis, and lipid transport between the ER and late endosomes/lysosomes (PMID: 37247681; 29097544; 33912962).