PEBP1 Recombinant monoclonal antibody, PBS Only (Detector)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PEBP1 Recombinant monoclonal antibody, PBS Only (Detector) (88106-2-PBS)

PEBP1 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 88106-2-PBS Copied!

Clone No. 260328A6

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

• 

  Sandwich ELISA sample test of MP03431-1

  The mean PEBP1/RKIP concentration was determined to be 152.81 ng/mL in HepG2 cell extract based on a 1.20 mg/mL extract load, 33.07 ng/mL in MDA-MB-453 cell extract based on a 1.50 mg/mL extract load and 11.53 ng/mL in DU 145 cell extract based on a 1.20 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA sample test of MP03431-1

  Serum of eight individual healthy human donors was measured. The PEBP1/RKIP concentration of detected samples was determined to be 0.51 ng/mL with a range of 0.28-1.08 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA sample test of MP03431-1

  Plasma of eight individual healthy human donors was measured. The PEBP1/RKIP concentration of detected samples was determined to be 1.07 ng/mL with a range of 0.27-4.81 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA standard curve of MP03431-1

  Sandwich ELISA standard curve of MP03431-1, Human PEBP1/RKIP Recombinant Matched Antibody Pair - PBS only. 88106-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag0864. 88106-2-PBS was HRP conjugated as the detection antibody. Range: 0.391-25 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PEBP1 in ?

Chat with Able

---

Product Information

88106-2-PBS targets PEBP1 as part of a matched antibody pair:

MP03431-1: 88106-3-PBS capture and 88106-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0864

  Product name: Recombinant human PEBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 83-187 aa of BC008714

  Sequence: EWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

• Full Name: phosphatidylethanolamine binding protein 1
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: BC008714
• Gene Symbol: PEBP1
• Gene ID (NCBI): 5037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30086
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.