CoraLite®594-conjugated PEBP1 Monoclonal antibody

• 

  IF Staining of A549 using CL594-66438

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using CoraLite®594 PEBP1 antibody (CL594-66438, Clone: 2D4D11 ) at dilution of 1:200.

PEBP1 Monoclonal Antibody for IF/ICC

Cat No. CL594-66438

Clone No.2D4D11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

HCNP, HCNPpp, Neuropolypeptide h3, PBP, PEBP, PEBP 1, PEBP1, Prostatic binding protein, Raf kinase inhibitor protein, RKIP

---

Tested Applications

• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66438 targets PEBP1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0864

  Product name: Recombinant human PEBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 83-187 aa of BC008714

  Sequence: EWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

• Full Name: phosphatidylethanolamine binding protein 1
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 23-27 kDa
• GenBank Accession Number: BC008714
• Gene Symbol: PEBP1
• Gene ID (NCBI): 5037
• RRID: AB_3084712
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P30086
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Raf kinase inhibitor protein (RKIP), also termed phosphatidylethanolamine binding protein PEBP1, was initially identified as a potent inhibitor of Raf-1/MEK/ERK, NF-kB, and G-protein-coupled receptor signaling pathways. Later RKIP has been further identified as a metastasis suppressor and its loss of expression has been reported in various cancers. Its expression has been proposed as a prognostic marker for patients diagnosed with the above cancers.