Tested Applications
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-66438 targets PEBP1/RKIP in IF/ICC applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0864 Product name: Recombinant human PEBP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 83-187 aa of BC008714 Sequence: EWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK Predict reactive species |
| Full Name | phosphatidylethanolamine binding protein 1 |
| Calculated Molecular Weight | 21 kDa |
| Observed Molecular Weight | 23-27 kDa |
| GenBank Accession Number | BC008714 |
| Gene Symbol | PEBP1 |
| Gene ID (NCBI) | 5037 |
| RRID | AB_3084712 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Excitation Laser | Yellow-Green Laser (561 nm) |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P30086 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Raf kinase inhibitor protein (RKIP), also termed phosphatidylethanolamine binding protein PEBP1, was initially identified as a potent inhibitor of Raf-1/MEK/ERK, NF-kB, and G-protein-coupled receptor signaling pathways. Later RKIP has been further identified as a metastasis suppressor and its loss of expression has been reported in various cancers. Its expression has been proposed as a prognostic marker for patients diagnosed with the above cancers.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 PEBP1/RKIP antibody CL594-66438 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

