CoraLite® Plus 488-conjugated PEBP1 Monoclonal antibody

• 

  IF Staining of A549 using CL488-66438

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using CoraLite® Plus 488 PEBP1 antibody (CL488-66438, Clone: 2D4D11 ) at dilution of 1:200.

• 

  FC experiment of PC-12 using CL488-66438

  1X10^6 PC-12 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human PEBP1 (CL488-66438, Clone:2D4D11) (red), or 0.4 ug Mouse IgG1 Isotype Control (CL488-66360, Clone: T1F8D3F10) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

PEBP1 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-66438

Clone No.2D4D11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

RKIP, HCNP, HCNPpp, Neuropolypeptide h3, PBP

---

Tested Applications

• Positive IF/ICC detected in: A549 cells
• Positive FC (Intra) detected in: PC-12 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66438 targets PEBP1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0864

  Product name: Recombinant human PEBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 83-187 aa of BC008714

  Sequence: EWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

• Full Name: phosphatidylethanolamine binding protein 1
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 23-27 kDa
• GenBank Accession Number: BC008714
• Gene Symbol: PEBP1
• Gene ID (NCBI): 5037
• RRID: AB_2919325
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P30086
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Raf kinase inhibitor protein (RKIP), also termed phosphatidylethanolamine binding protein PEBP1, was initially identified as a potent inhibitor of Raf-1/MEK/ERK, NF-kB, and G-protein-coupled receptor signaling pathways. Later RKIP has been further identified as a metastasis suppressor and its loss of expression has been reported in various cancers. Its expression has been proposed as a prognostic marker for patients diagnosed with the above cancers.