PEF1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PEF1 Polyclonal antibody (10151-1-AP)

PEF1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 10151-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, IF, ELISA

Synonyms

ABP32, PEF1, PEF1A, PEFLIN

• 

  WB analysis using 10151-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10151-1-AP (PEF1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 10151-1-AP

  IP result of anti-PEF1 (IP:10151-1-AP, 4ug; Detection:10151-1-AP 1:500) with HEK-293 cells lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PEF1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells, HeLa cells
• Positive IP detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10151-1-AP targets PEF1 in WB, IP, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0198

  Product name: Recombinant human PEF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 117-284 aa of BC002773

  Sequence: PEAYSWFQSVDSDHSGYISMKELKQALVNCNWSSFNDETCLMMINMFDKTKSGRIDVYGFSALWKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRYCPRSANPAMQLDRFIQVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTASRML

• Full Name: penta-EF-hand domain containing 1
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC002773
• Gene Symbol: PEF1
• Gene ID (NCBI): 553115
• RRID: AB_2161168
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBV8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Anti-H2AX antibody, catalog number 10151-1-AP, has 1 total citation. It appears in Journal of Proteome Research (IF 3.8), published in 2010. The cited study focused on proteomic analysis of H2AX-interacting protein complexes in hepatocellular carcinoma, utilizing the antibody for Western blot and immunofluorescence in human samples. The associated research field is cancer proteomics / DNA damage response.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	J Proteome Res; Proteomic dissection of cell type-specific H2AX-interacting protein complex associated with hepatocellular carcinoma.; Authors - Yang Xiaoli X