Twinkle/PEO1 Polyclonal antibody

• 

  WB analysis of HeLa using 13435-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13435-1-AP (Twinkle antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 13435-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13435-1-AP (Twinkle antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse skeletal muscle using 13435-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 13435-1-AP (Twinkle antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 13435-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 13435-1-AP (Twinkle antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Twinkle/PEO1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13435-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Twinkle, PEO1, PEO, IOSCA, EC:5.6.2.3

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells
• Positive IHC detected in: mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below

Product Information

13435-1-AP targets Twinkle/PEO1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4239

  Product name: Recombinant human PEO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 154-506 aa of BC033762

  Sequence: LVRPGDQQPRPLEALNGGFNLSRILRTALPAWHKSIVSFRQLREEVLGELSNVEQAAGLRWSRFPDLNRILKGHRKGELTVFTGPTGSGKTTFISEYALDLCSQGVNTLWGSFEISNVRLARVMLTQFAEGRLEDQLDKYDHWADRFEDLPLYFMTFHGQQSIRTVIDTMQHAVYVYDICHVIIDNLQFMMGHEQLSTDRIAAQDYIIGVFRKFATDNNCHVTLVIHPRKEDDDKELQTASIFGSAKASQEADNVLILQDRKLVTGPGKRYLQVSKNRFDGDVGVFPLEFNKNSLTFSIPPKNKARLKKIKDDTGPVAKKPSSGKKGATTQNSEICSGQAPTPDQPDTSKRSK

• Full Name: chromosome 10 open reading frame 2
• Calculated Molecular Weight: 684 aa, 77 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC033762
• Gene Symbol: PEO1
• Gene ID (NCBI): 56652
• RRID: AB_10644286
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96RR1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Twinkle, also named as C10orf2, PEO1, is a 684 amino acid protein, which forms multimers in vitro, including hexamers. Twinkle colocalizes with mtDNA in mitochondrial nucleoids, a nucleoproteins complex consisting of a number of copies of proteins associated with mtDNA, probably involved in mtDNA maintenance and expression. Twinkle involves in mitochondrial DNA (mtDNA) metabolism and could function as an adenine nucleotide-dependent DNA helicase. Twinkle exists various isoform and molecular weight of isoform is 60 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; Mitofusin 1 and 2 regulation of mitochondrial DNA content is a critical determinant of glucose homeostasis.; Authors - Vaibhav Sidarala
human		EMBO J; ATAD3B is a mitophagy receptor mediating clearance of oxidative stress-induced damaged mitochondrial DNA.; Authors - Li Shu
human	WB	Cell Rep; Sam50 Regulates PINK1-Parkin-Mediated Mitophagy by Controlling PINK1 Stability and Mitochondrial Morphology.; Authors - Fenglei Jian
mouse	WB	Cell Death Differ; Mic60/Mitofilin determines MICOS assembly essential for mitochondrial dynamics and mtDNA nucleoid organization.; Authors - H Li
mouse	WB	Sci Rep; PMID: 28397817; Authors - Xinbin Zhao
human	WB	Nucleic Acids Res; A deafness-associated mitochondrial DNA mutation caused pleiotropic effects on DNA replication and tRNA metabolism; Authors - Feilong Meng