PET100 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PET100 Polyclonal antibody, PBS Only (31322-1-PBS)

• 

  IHC staining of human colon cancer using 31322-1-AP (same clone as 31322-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 31322-1-AP (PET100 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31322-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 31322-1-AP (same clone as 31322-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 31322-1-AP (PET100 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31322-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 31322-1-AP (same clone as 31322-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 31322-1-AP (PET100 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31322-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 31322-1-AP (same clone as 31322-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 31322-1-AP (PET100 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31322-1-PBS in a different storage buffer formulation.

PET100 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 31322-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

LOC100131801, similar to hCG2036585

---

Product Information

31322-1-PBS targets PET100 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34524

  Product name: Recombinant human PET100 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-73 aa of NM_001171155

  Sequence: MGVKLEIFRMIIYLTFPVAMFWVSNQAEWFEDDVIQRKRELWPPEKLQEIEEFKERLRKRREEKLLRDAQQNS

• Full Name: Protein PET100 homolog, mitochondrial
• Calculated Molecular Weight: 9 kDa
• GenBank Accession Number: NM_001171155
• Gene Symbol: PET100
• Gene ID (NCBI): 100131801
• RRID: AB_3742417
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P0DJ07
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.