Product Information
31066-1-PBS targets PET117 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34525 Product name: Recombinant human PET117 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 23-81 aa of NX_Q6UWS5 Sequence: VHVKQQWDQQRLRDGVIRDIERQIRKKENIRLLGEQIILTEQLEAEREKMLLAKGSQKS Predict reactive species |
| Full Name | Protein PET117 homolog, mitochondrial |
| Calculated Molecular Weight | 81aa, 9 kDa |
| Observed Molecular Weight | 10kDa |
| GenBank Accession Number | NX_Q6UWS5 |
| Gene Symbol | PET117 |
| Gene ID (NCBI) | 100303755 |
| RRID | AB_3669839 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q6UWS5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
PET117 is a chaperone protein involved in complex IV assembly that plays a role in the regulation of mitochondria-encoded cytochrome c oxidase 1 (COX1) protein synthesis in human cells (PMID: 37247699).





