PEX1 Monoclonal antibody

PEX1 Monoclonal Antibody for WB, ELISA
Cat No. 67436-1-Ig
Clone No.2F3H5

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, ELISA

2F3H5, EC:3.6.4.-, Peroxin 1, Peroxin-1, Peroxisomal ATPase PEX1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, HepG2 cells, L02 cells, Jurkat cells, THP-1 cells, HSC-T6 cells, NIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67436-1-Ig targets PEX1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4623

Product name: Recombinant human PEX1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 927-1283 aa of BC035575

Sequence: IRAQAAKPCILFFDEFESIAPRRGHDNTGVTDRVVNQLLTQLDGVEGLQGVYVLAATSRPDLIDPALLRPGRLDKCVYCPPPDQVSRLEILNVLSDSLPLADDVDLQHVASVTDSFTGADLKALLYNAQLEALHGMLLSSGLQDGSSSSDSDLSLSSMVFLNHSSGSDDSAGDGECGLDQSLVSLEMSEILPDESKFNMYRLYFGSSYESELGNGTSSDLSSQCLSAPSSMTQDLPGVPGKDQLFSQPPVLRTASQEGCQELTQEQRDQLRADISIIKGRYRSQSGEDESMNQPGPIKTRLAISQSHLMTALGHTRPSISEDDWKNFAELYESFQNPKRRKNQSGTMFRPGQKVTLA

Predict reactive species
Full Name peroxisomal biogenesis factor 1
Calculated Molecular Weight 1283 aa, 143 kDa
Observed Molecular Weight 143 kDa
GenBank Accession NumberBC035575
Gene Symbol PEX1
Gene ID (NCBI) 5189
RRIDAB_2882673
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO43933
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Peroxin (PEX) proteins generate and maintain peroxisomes. The peroxin-1 (PEX1) ATPase facilitates the recycling of the peroxisome matrix protein receptor PEX5 and is the most commonly affected peroxin in human peroxisome biogenesis disorders (PMID: 28600347).  PEX1 and PEX6 are the only members of the AAA family (for ATPases associated with diverse cellular) activities implicated in peroxisome biogenesis and are closely related to p97, which functions in endoplasmic reticulum-associated protein degradation to retrotranslocate endoplasmic reticulum proteins to the cytosol (PMID: 9695811; 11740563).

Protocols

Product Specific Protocols
WB protocol for PEX1 antibody 67436-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...