PEX12 Polyclonal antibody

• 

  WB analysis of MCF-7 using 27011-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 27011-1-AP (PEX12 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 27011-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 27011-1-AP (PEX12 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 27011-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 27011-1-AP (PEX12 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 27011-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 27011-1-AP (PEX12 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 27011-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 27011-1-AP (PEX12 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

PEX12 Polyclonal Antibody for WB, ELISA

Cat No. 27011-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, ELISA

Synonyms

PEX, Peroxisome assembly protein 12, Peroxisome assembly factor 3, Peroxin-12, Peroxin 12

---

Tested Applications

• Positive WB detected in: MCF-7 cells, A549 cells, HeLa cells, HepG2 cells, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

27011-1-AP targets PEX12 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25500

  Product name: Recombinant human PEX12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-154 aa of BC031085

  Sequence: MAEHGAHFTAASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPTHYGFLWRWFDEIFTLLDLLLQQHYLSRTSASFSENFYGLKRIVMGDTHKSQRLASAGLPKQQLWKSIMFLVLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKR

• Full Name: peroxisomal biogenesis factor 12
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 40-42 kDa
• GenBank Accession Number: BC031085
• Gene Symbol: PEX12
• Gene ID (NCBI): 5193
• RRID: AB_2880720
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00623
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Peroxisome assembly protein 12 (PEX12), also known as Peroxisome assembly factor 3 (PAF-3), is an integral peroxisomal membrane protein that is essential for peroxisomal matrix protein import and is one of only two peroxins known to interact with the ligand-binding domain of PEX5. Mutations in human PEX12 result in Zellweger syndrome, a lethal neurological disorder, and implicate the zinc ring domain in PEX12 function (PMID: 12456682). Pex12 exhibits protein-Ub ligase activity with specificity for the E2 protein Pex4 and Ubc4 (PMID: 19687296).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Commun Biol; PEX3 promotes regenerative repair after myocardial injury in mice through facilitating plasma membrane localization of ITGB3; Authors - Jia-Teng Sun
pig	WB	PLoS Pathog; SIRT5-mediated desuccinylation of the porcine deltacoronavirus M protein drives pexophagy to enhance viral proliferation; Authors - Zhuang Li