• Featured Product
  • KD/KO Validated

PEX5 Monoclonal antibody, PBS Only

PEX5 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 66309-1-PBS
Clone No.1C2C3

Host / Isotype

Mouse / IgG1

Reactivity

human, pig, rat

Applications

WB, IHC, Indirect ELISA

Cell and organelle markers, Peroxin 5, Peroxisome Marker, Peroxisome receptor 1, PEX5, PTS1 BP, PTS1 receptor, PTS1R, PXR1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66309-1-PBS targets PEX5 in WB, IHC, Indirect ELISA applications and shows reactivity with human, pig, rat samples.

Tested Reactivity human, pig, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3268

Product name: Recombinant human PEX5 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 340-639 aa of BC010621

Sequence: EGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ

Predict reactive species
Full Name peroxisomal biogenesis factor 5
Calculated Molecular Weight 631 aa, 70 kDa
Observed Molecular Weight 70-80 kDa
GenBank Accession NumberBC010621
Gene Symbol PEX5
Gene ID (NCBI) 5830
RRIDAB_2881691
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP50542
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The peroxisomal targeting signal type1 (PTS1) receptor, PEX5, is one member of peroxins (PEXs) which are proteins required for peroxisome assembly. PEX5 and PEX7 function as receptors that recognize PTS1- and PTS2- containing proteins, respectively, and PEX5 binds PTS1 through its C-terminal 40-kDa tetratricopeptide repeat domain. It is a predominantly cytoplasmic, partly peroxisomal protein that appears to shuttle between these compartments as it mediates the import of PTS1-containing proteins. PEX5 has been reported to interact with PEX10, PEX12, PEX13, and PEX14. Defects in PEX5 are a cause of Zellweger syndrome (ZWS), which is a lethal peroxisome biogenesis disorder.

Loading...
||
New chat Able
正在加载,请稍候...