PEX5L Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PEX5L Polyclonal antibody (13084-1-AP)

PEX5L Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 13084-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

Synonyms

Peroxin 5 related protein, PEX2 related protein, PEX5 like protein, PEX5 related protein, PEX5L, PEX5R, Pex5Rp, PXR2, PXR2B

• 

  WB analysis of mouse brain using 13084-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13084-1-AP (PEX5L antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 13084-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13084-1-AP (PEX5L antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 13084-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 13084-1-AP (PEX5L antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 13084-1-AP

  IP result of anti-PEX5L (IP:13084-1-AP, 4ug; Detection:13084-1-AP 1:300) with mouse brain tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 13084-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13084-1-AP (PEX5L antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 13084-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13084-1-AP (PEX5L antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PEX5L in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13084-1-AP targets PEX5L in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3749

  Product name: Recombinant human PEX5L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 291-591 aa of BC036183

  Sequence: WPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQQDACDALKNWIKQNPKYKYLVKSKKGSPGLTRRMSKSPVDSSVLEGVKELYLEAAHQNGDMIDTDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSRNQQQVPHPAISGNIWAALRIALSLMDQPELFQAANLGDLDVLLRAFNLDP

• Full Name: peroxisomal biogenesis factor 5-like
• Calculated Molecular Weight: 626 aa, 70 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC036183
• Gene Symbol: PEX5L
• Gene ID (NCBI): 51555
• RRID: AB_2877914
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IYB4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The PEX5L Polyclonal antibody (Cat# 13084-1-AP) has 1 total citation. It appears in Molecular Psychiatry (IF 10.4), published in July 2022. The cited study investigated how glucocorticoid-glucocorticoid receptor-HCN1 channels reduce neuronal excitability in dorsal hippocampal CA1 neurons, placing the research in the fields of neuroscience and neuroendocrinology. The antibody was applied via IHC in mouse tissue.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Mol Psychiatry; Glucocorticoid-glucocorticoid receptor-HCN1 channels reduce neuronal excitability in dorsal hippocampal CA1 neurons.; Authors - Jiwon Kim