Mouse CXCL4/PF4 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 85738-1-RR (same clone as 85738-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85738-1-RR (CXCL4/PF4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85738-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human peripheral blood platelets using 85738-1-RR (same clone as 85738-1-PBS)

  human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 85738-1-RR (PF4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85738-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 85738-1-RR (same clone as 85738-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85738-1-RR (CXCL4/PF4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85738-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP02069-1

  Cytometric bead array standard curve of MP02069-1, MOUSE CXCL4/PF4 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85738-1-PBS. Detection antibody: 85738-2-PBS. Standard: Eg3345. Range: 0.781-100 ng/mL.

CXCL4/PF4 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 85738-1-PBS

Clone No.242741H5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

C-X-C motif chemokine 4, CXCL4, PF-4, Platelet factor 4

---

Product Information

85738-1-PBS targets CXCL4/PF4 as part of a matched antibody pair:

MP02069-1: 85738-1-PBS capture and 85738-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3345

  Product name: Recombinant Mouse CXCL4/PF4 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 30-105 aa of NM_019932

  Sequence: VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES

• Full Name: platelet factor 4
• Calculated Molecular Weight: 11kd
• Observed Molecular Weight: 10-14 kDa
• GenBank Accession Number: NM_019932
• Gene Symbol: Pf4
• Gene ID (NCBI): 56744
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Z126
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The chemokine (C-X-C motif) ligand 4 (CXCL4) is also named as PF4 (Platelet factor-4) and SCYB4. The platelets, the most abundant source of CXCL4 in vivo, control profibrotic macrophage activation via CXCL4. (PMID: 36807143). Exogenous CXCL4 drove profibrotic activation of monocyte-derived dendritic cells in vitro (PMID: 33042127). Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation.