PFKFB1 Polyclonal antibody

PFKFB1 Polyclonal Antibody for IHC, ELISA

Cat No. 21718-1-AP

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

6PF-2-K/Fru-2,6-P2ase 1, 6PF-2-K/Fru-2,6-P2ase liver isozyme, 6-phosphofructo-2-kinase, 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1, F6PK

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllIHC

IHC staining of human liver cancer using 21718-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 21718-1-AP (PFKFB1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 21718-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 21718-1-AP (PFKFB1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PFKFB1 in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive IHC detected in

human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

Application	Dilution
Immunohistochemistry (IHC)	IHC : 1:100-1:400
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21718-1-AP targets PFKFB1 in IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag16362 Product name: Recombinant human PFKFB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 138-241 aa of BC096079 Sequence: ERRSLILQFAKEHGYKVFFIESICNDPGIIAENIRQVKLGSPDYIDCDREKVLEDFLKRIECYEVNYQPLDEELDSHLSYIKIFDVGTRYMVNRVQDHIQSRTV Predict reactive species
Full Name	6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1
Calculated Molecular Weight	471 aa, 55 kDa
GenBank Accession Number	BC096079
Gene Symbol	PFKFB1
Gene ID (NCBI)	5207
RRID	AB_2878911
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P16118
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.