PFKFB3 Monoclonal antibody, PBS Only (Detector)

PFKFB3 Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 60241-1-PBS
Clone No.4D1B11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

Cytometric bead array, Indirect ELISA

6PF-2-K/Fru-2,6-P2ase 3, 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme, 6-phosphofructo-2-kinase, 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3, Fructose-2,6-bisphosphatase

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60241-1-PBS targets PFKFB3 as part of a matched antibody pair:

MP51513-1: 60241-2-PBS capture and 60241-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4737

Product name: Recombinant human PFKFB3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 243-520 aa of BC040482

Sequence: HVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH

Predict reactive species
Full Name 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
Calculated Molecular Weight 520 aa, 60 kDa
Observed Molecular Weight 55-58 kDa
GenBank Accession NumberBC040482
Gene Symbol PFKFB3
Gene ID (NCBI) 5209
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ16875
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PFKFB3, also named as NY-REN-56 and iPFK-2, plays a role in glucose metabolism. It synthesis and degradation of fructose 2,6-bisphosphate. Endogenously generated adenosine cooperates with bacterial components to increase PFKFB3 isozyme activity, resulting in greater fructose 2,6-bisphosphate accumulation. PFKFB3 is required for increased growth, metabolic activity and is regulated through active JAK2 and STAT5.

Loading...
||
New chat

Able

正在加载,请稍候...