PFN3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PFN3 Polyclonal antibody (25188-1-AP)

• 

  WB analysis using 25188-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25188-1-AP (PFN3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

PFN3 Polyclonal Antibody for WB, ELISA

Cat No. 25188-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Profilin-III, profilin-3

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25188-1-AP targets PFN3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18131

  Product name: Recombinant human PFN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-137 aa of BC132952

  Sequence: MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRHTFLQAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGILNKTVHELIRGLRMQGA

• Full Name: profilin 3
• Calculated Molecular Weight: 137 aa, 15 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC132952
• Gene Symbol: PFN3
• Gene ID (NCBI): 345456
• RRID: AB_3742139
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P60673
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PFN3 also known as profilin-3, belongs to the profilin family, a family of actin-binding proteins that regulate the dynamics of actin in cells. PFN3 may be involved in spermatogenesis. (PMID: 11867228). Deletion or abnormal function of PFN3 may lead to male infertility, especially in disorders associated with abnormal sperm acrosome development (spherozoospermia)(PMID: 34869336).