PGAM5 Monoclonal antibody, PBS Only

• 

  WB analysis using 68116-1-Ig (same clone as 68116-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68116-1-Ig (PGAM5 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 68116-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit brain using 68116-1-Ig (same clone as 68116-1-PBS)

  rabbit brain tissue were subjected to SDS PAGE followed by western blot with 68116-1-Ig (PGAM5 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68116-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 68116-1-Ig (same clone as 68116-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 68116-1-Ig (PGAM5 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68116-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 68116-1-Ig (same clone as 68116-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 68116-1-Ig (PGAM5 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68116-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 68116-1-Ig (same clone as 68116-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 68116-1-Ig (PGAM5 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68116-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 68116-1-Ig (same clone as 68116-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 68116-1-Ig (PGAM5 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68116-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 68116-1-Ig (same clone as 68116-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 68116-1-Ig (PGAM5 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68116-1-PBS in a different storage buffer formulation.

PGAM5 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 68116-1-PBS

Clone No.1C8B9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, ELISA

Synonyms

1C8B9, Bcl-XL-binding protein v68, BXLBv68, EC:3.1.3.16, Serine/threonine-protein phosphatase PGAM5, mitochondrial

---

Product Information

68116-1-PBS targets PGAM5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28195

  Product name: Recombinant human PGAM5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-255 aa of BC008196

  Sequence: MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCSIPPLLSAGDFVVLGS

• Full Name: phosphoglycerate mutase family member 5
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC008196
• Gene Symbol: PGAM5
• Gene ID (NCBI): 192111
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96HS1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Phosphoglycerate mutase 5 (PGAM5) is a mitochondrial Serine (Ser)/Threonine (Thr) phosphatase normally located in the inner mitochondrial membrane. Upon mitochondrial dysfunction, PGAM5 recruits and dephosphorylates Drp1 at Ser-637, triggers its GTPase activity and promotes mitochondrial fission. PGAM5 regulates mitophagy by stabilizing PINK1 under stress conditions, which recruits E3 ubiquitin ligase PARKIN for degradation of the damaged mitochondria. PGAM5 can be cleaved and released to the cytoplasm through PARKIN, which activates Wnt signaling and induces mitochondrial biogenesis (PMID: 32439975). PGAM5 has 2 isoforms with the molecular mass of 28 and 32 kDa.