PGBD2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PGBD2 Polyclonal antibody (32839-1-AP)

• 

  WB analysis using 32839-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32839-1-AP (PGBD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

PGBD2 Polyclonal Antibody for WB, ELISA

Cat No. 32839-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

PiggyBac transposable element-derived protein 2

---

Tested Applications

• Positive WB detected in: A431 cells, MDA-MB-231 cells, Raji cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32839-1-AP targets PGBD2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38500

  Product name: Recombinant human PGBD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of NM_170725.2

  Sequence: MASTSRDVIAGRGIHSKVKSAKLLEVLNAMEEEESNNNREEIFIAPPDNAAGEFTDEDSGDEDSQRGAHLPGSVLHASVLCEDSGTGEDNDDLELQPAKKRQKAVVKPQRIWTKRDIRPDFGSWTASDPHIEDLKSQELSPVGLFELFFD

• Full Name: piggyBac transposable element derived 2
• Calculated Molecular Weight: 68kDa，592aa
• Observed Molecular Weight: 71 kDa
• GenBank Accession Number: NM_170725.2
• Gene Symbol: PGBD2
• Gene ID (NCBI): 267002
• RRID: AB_3742758
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6P3X8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. The exact function of this gene is not known. Two transcript variants encoding different isoforms have been found for this gene.