PGC Polyclonal antibody

• 

  WB analysis using 28532-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28532-1-AP (PGC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach using 28532-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 28532-1-AP (PGC antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach using 28532-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 28532-1-AP (PGC antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PGC Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28532-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Pepsinogen II, EC:3.4.23.3, PGⅡ

---

Tested Applications

• Positive WB detected in: mouse stomach tissue, rat stomach tissue
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

28532-1-AP targets PGC in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29347

  Product name: Recombinant human PGC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-90 aa of BC073740

  Sequence: MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMDAAYFGEISIGTPPQNFLVLF

• Full Name: progastricsin (pepsinogen C)
• Calculated Molecular Weight: 388 aa, 42 kDa
• Observed Molecular Weight: 34-42 kDa
• GenBank Accession Number: BC073740
• Gene Symbol: PGC
• Gene ID (NCBI): 5225
• RRID: AB_2918173
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20142
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pepsinogen II also known as progastricsin or PGC(pepsinogen C), is an aspartic protease expressed primarily in gastric chief cells and is a novel marker of type 2 cells with advantages over many of the current markers used to identify type 2 cells in the developing lung(PMID:14578117). It is involved in proteolysis and peptidolysis. This protein has 2 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Biosci; Hif-2α regulates lipid metabolism in alcoholic fatty liver disease through mitophagy; Authors - Mei-Fei Wu
human	WB	Transgenic Res; The potential oncogenic effect of tissue-specific expression of JC polyoma T antigen in digestive epithelial cells; Authors - Hua-Chuan Zheng