Tested Applications
| Positive WB detected in | mouse stomach tissue, rat stomach tissue |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28532-1-AP targets Pepsinogen II/PGC in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29347 Product name: Recombinant human PGC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC073740 Sequence: MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMDAAYFGEISIGTPPQNFLVLF Predict reactive species |
| Full Name | progastricsin (pepsinogen C) |
| Calculated Molecular Weight | 388 aa, 42 kDa |
| Observed Molecular Weight | 34-42 kDa |
| GenBank Accession Number | BC073740 |
| Gene Symbol | PGC |
| Gene ID (NCBI) | 5225 |
| RRID | AB_2918173 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P20142 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Pepsinogen II also known as progastricsin or PGC(pepsinogen C), is an aspartic protease expressed primarily in gastric chief cells and is a novel marker of type 2 cells with advantages over many of the current markers used to identify type 2 cells in the developing lung(PMID:14578117). It is involved in proteolysis and peptidolysis. This protein has 2 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Pepsinogen II/PGC antibody 28532-1-AP | Download protocol |
| WB protocol for Pepsinogen II/PGC antibody 28532-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Pepsinogen II/PGC Polyclonal antibody (Cat# 28532-1-AP) has a total of 3 citations. These appear in Cell Mol Immunol, Cell Biosci, and Transgenic Res. The associated research fields include tumor immunology and CD8+ T cell exhaustion, lipid metabolism in alcoholic fatty liver disease via mitophagy, and the oncogenic effects of JC polyoma virus in digestive epithelial cells. All citations used the antibody for Western blot applications in human or mouse samples.
| Species | Application | Title |
|---|---|---|
Cell Mol Immunol PARK7-induced delactylation of ATAD3A impairs mitochondrial fitness to promote exhaustion of tumor-infiltrating CD8+ T cells | ||
Cell Biosci Hif-2α regulates lipid metabolism in alcoholic fatty liver disease through mitophagy | ||
Transgenic Res The potential oncogenic effect of tissue-specific expression of JC polyoma T antigen in digestive epithelial cells |
