PGCP Recombinant monoclonal antibody, PBS Only

PGCP Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 86405-1-PBS
Clone No.251059H3

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, Indirect ELISA

Carboxypeptidase Q, CPQ, EC:3.4.17.-, LCH1, Lysosomal dipeptidase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86405-1-PBS targets PGCP in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9770

Product name: Recombinant human PGCP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 123-472 aa of BC020689

Sequence: LEPRIHKIAILGLGSSIGTPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMGAKTYPDTDSFNTVAEITGSKYPEQVVLVSGHLDSWDVGQGAMDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLHKVNISNYSLVMESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGASLLDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVSYVVADMEEMLPRS

Predict reactive species
Full Name plasma glutamate carboxypeptidase
Calculated Molecular Weight 472 aa, 52 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC020689
Gene Symbol PGCP
Gene ID (NCBI) 10404
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y646
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PGCP(plasma glutamate carboxypeptidase) is also named as LCH1,CPQ and belongs to the peptidase M28 family. It may play an important role in the hydrolysis of circulating peptides. It catalyzes more efficiently the hydrolysis of dipeptides with unsubstituted terminals into amino acids. It is a proteinase that acts on the unsubstituted N- and C-termini of dipeptides. It has been suggested that this PGCP is involved in the release of thyroxine(PMID:20951214). Human PGCP is a metallopeptidase with five potential glycosylation sites, whose activity depends on dimerizationand it can be detected a band of 65-72kd in FRTL-5 cells which is pro-PGCP(PMID:22127294). It can be N-glycosylated(PMID:10206990). It has the pro-form of 60-65 kDa and mature form of 55 kDa(PMID:20951214).

Loading...
||
New chat

Able

正在加载,请稍候...