HPGDS Recombinant monoclonal antibody, PBS Only

• 

  Affinity of 85446-3-PBS

  Biolayer interferometry (BLl) kinetic assay of 85446-3-PBS against Human HPGDS was performed. The affinity constant is 0.179 nM.

HPGDS Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 85446-3-PBS

Clone No.242980D6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

EC:2.5.1.18, EC:5.3.99.2, Glutathione S transferase, Glutathione S-transferase, Glutathione-dependent PGD synthase

---

Product Information

85446-3-PBS targets HPGDS in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18290

  Product name: Recombinant human PGDS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-199 aa of BC020734

  Sequence: MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL

• Full Name: prostaglandin D2 synthase, hematopoietic
• Calculated Molecular Weight: 199 aa, 23 kDa
• GenBank Accession Number: BC020734
• Gene Symbol: HPGDS
• Gene ID (NCBI): 27306
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60760
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.