PGF/PIGF Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83170-2-PBS

  Biolayer interferometry (BLl) kinetic assays of 83170-2-PBS against Human PGF/PIGF were performed. The affinity constant is below 1 pM.

PGF/PIGF Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 83170-2-PBS

Clone No.230532C12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

PGF, PGFL, PIGF, PLGF, Placenta growth factor

---

Product Information

83170-2-PBS targets PGF/PIGF in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0969

  Product name: Recombinant human PGF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-170 aa of BC007789

  Sequence: MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

• Full Name: placental growth factor
• Calculated Molecular Weight: 25 kDa
• GenBank Accession Number: BC007789
• Gene Symbol: PGF
• Gene ID (NCBI): 5228
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49763
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.