PGLYRP4 Polyclonal antibody

• 

  IHC staining of rat skin using 21134-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skin tissue slide using 21134-1-AP (PGLYRP4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 21134-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 21134-1-AP (PGLYRP4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PGLYRP4 Polyclonal Antibody for IHC, ELISA

Cat No. 21134-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

Synonyms

PGRPIB, Peptidoglycan recognition protein I-beta, PGLYRPIbeta, PGRP I beta, PGRP Ibeta

---

Tested Applications

• Positive IHC detected in: mouse skin tissue, rat skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21134-1-AP targets PGLYRP4 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15539

  Product name: Recombinant human PGLYRP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 18-113 aa of BC142636

  Sequence: DSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKAWGAEAVGCSIQLTTPVNVLVIHHVPGLECHDQTVCSQRLRELQAHHVHNNSGC

• Full Name: peptidoglycan recognition protein 4
• Calculated Molecular Weight: 373 aa, 41 kDa
• GenBank Accession Number: BC142636
• Gene Symbol: PGLYRP4
• Gene ID (NCBI): 57115
• RRID: AB_2878817
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96LB8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.