PHACTR4 Polyclonal antibody

• 

  WB analysis of mouse eye using 13408-1-AP

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 13408-1-AP (PHACTR4 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 13408-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 13408-1-AP (PHACTR4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 13408-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 13408-1-AP (PHACTR4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 13408-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 13408-1-AP (PHACTR4 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 13408-1-AP

  Immunofluorescent analysis of A431 cells using 13408-1-AP (PHACTR4 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

PHACTR4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13408-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PRO2963

---

Tested Applications

• Positive WB detected in: mouse eye tissue, A431 cells, human liver tissue
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

13408-1-AP targets PHACTR4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4054

  Product name: Recombinant human PHACTR4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 403-702 aa of BC029266

  Sequence: FGEPHIPSRLPPLPLHIRIQQALTSPLPMTPILEGSHRAHSLLFENSDSFSEDSSTLGRTRSLPITIEMLKVPDDEEEEEQTCPSTFSEEMTPTSVIPKLPQCLREEEEKESDSDSEGPIQYRDEEDEDESYQSALANKVKRKDTLAMKLNHRPSEPELNLNSWPCKSKEEWNEIRHQIGNTLIRRLSQRPTPEELEQRNILQPKNEADRQAEKREIKRRLTRKLSQRPTVAELLARKILRFNEYVEVTDAQDYDRRADKPWTKLTPADKAAIRKELNEFKSSEMEVHEESKHFTRYHRP

• Full Name: phosphatase and actin regulator 4
• Calculated Molecular Weight: 702 aa, 78 kDa
• Observed Molecular Weight: 71-78 kDa
• GenBank Accession Number: BC029266
• Gene Symbol: PHACTR4
• Gene ID (NCBI): 65979
• RRID: AB_10638316
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IZ21
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Int J Biol Macromol; Targeting Phactr4 to rescue chronic stress-induced depression-like behavior in rats via regulating neuroinflammation and neuroplasticity; Authors - Ye Li