PHD1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86614-2-RR (same clone as 86614-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86614-2-RR (EGLN2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86614-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 86614-2-RR (same clone as 86614-2-PBS)

  Rat testis tissue were subjected to SDS PAGE followed by western blot with 86614-2-RR (EGLN2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86614-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86614-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86614-2-RR against Human PHD1 were performed. The affinity constant is 0.587 nM.

PHD1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86614-2-PBS

Clone No.251511G2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

EGLN2, EC:1.14.11.-, EC:1.14.11.29, EIT6, EIT-6

---

Product Information

86614-2-PBS targets PHD1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3616

  Product name: Recombinant human EGLN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 190-407 aa of BC036051

  Sequence: GICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT

• Full Name: egl nine homolog 2 (C. elegans)
• Calculated Molecular Weight: 407 aa, 44 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC036051
• Gene Symbol: PHD1
• Gene ID (NCBI): 112398
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96KS0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PHD1, also named as EGLN2, EIT6 and HPH-3, catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. It hydroxylates HIF-1 alpha at 'Pro-402' and 'Pro-564', and HIF-2 alpha. EGLN2 functions as a cellular oxygen sensor and, under normoxic conditions, targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. It may play a role in cell growth regulation.