PHF10 Polyclonal antibody

PHF10 Polyclonal Antibody for ELISA
Cat No. 17145-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

BAF45a, BRG1 associated factor 45a, PHD finger protein 10, PHF10, XAP135

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

17145-1-AP targets PHF10 in ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10917

Product name: Recombinant human PHF10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-408 aa of BC020954

Sequence: MLQEQVSEYLGVTSFKRKYPERRDLSHKEKLYLRELNVITETQCTLGLTALRSDEVIDLMIKEYPAKHAEYSVILQEKERQRITDHYKEYSQMQQQNTQKVEASKVPEYIKKAAKKAAEFNSNLNRERMEERRAYFDLQTHVIQVPQGKYKVLPTERTKVSSYPVALIPGQFQEYYKRYSPDELRYLPLNTALYEPPLDPELPALDSDGDSDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVIPNAICGICLKGKESNKKGKAESLIHCSQCENSGHPSCLDMTMELVSMIKTYPWQCMECKTCIICGQPHHEEEMMFCDMCDRGYHTFCVGLGAIPSGRWICDCCQRAPPTPRKVGRRGKNSKEG

Predict reactive species
Full Name PHD finger protein 10
Calculated Molecular Weight 408 aa, 46 kDa
GenBank Accession NumberBC020954
Gene Symbol PHF10
Gene ID (NCBI) 55274
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WUB8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PHF10, also named as BRG1-associated factor 45a, is a 498 amino acid protein, which locate in the nucleus and Belongs to the SAYP family. PHF10 Involve in transcription activity regulation by chromatin remodeling. It Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and is required for the proliferation of neural progenitors. During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. PHF10 exists as several isoform and the calculated molecular weight of each isoform is 42 kDa, 37 kDa, 51 kDa, and 56 kDa.

Loading...
||
New chat Able
正在加载,请稍候...