PHF15 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PHF15 Polyclonal antibody, PBS Only (11513-1-PBS)

• 

  WB analysis of MDCK using 11513-1-AP (same clone as 11513-1-PBS)

  MDCK cells were subjected to SDS PAGE followed by western blot with 11513-1-AP (PHF15 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11513-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MDCK using 11513-1-AP (same clone as 11513-1-PBS)

  MDCK cells were subjected to SDS PAGE followed by western blot with 11513-1-AP (PHF15 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11513-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MDCK using 11513-1-AP (same clone as 11513-1-PBS)

  MDCK cells were subjected to SDS PAGE followed by western blot with 11513-1-AP (PHF15 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11513-1-PBS in a different storage buffer formulation.

PHF15 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 11513-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, canine

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

11513-1-PBS targets PHF15 in WB, Indirect ELISA applications and shows reactivity with human, canine samples.

• Tested Reactivity: human, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2073

  Product name: Recombinant human PHF15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC021962

  Sequence: MEEKRRKYSISSDNSDTTDSHATSTSASRCSKLPSSTKSGWPRQNEKKPSEVFRTDLITAMKIPDSYQLSPDDYYILADPWRQEWEKGVQVPAGAEAIPEPVVRILPPLEGPPAQASPSSTMLGEGSQPDWPGGSRYDLDEIDAYWLELINSELKEMERPELDELTLERVLEELETLCHQNMARAIETQEGLGIEYDEDVVCDVCRSPEGEDGNEMVFCDKCNVCVHQACYGILKVPTGSWLCRTCALGVQPKCLLCPKRGGALKPTRSGTKWVHVSCALWIPEVSIGCPEKMEPITKIS

• Full Name: PHD finger protein 15
• Calculated Molecular Weight: 791 aa, 88 kDa
• Observed Molecular Weight: 110-120 kDa
• GenBank Accession Number: BC021962
• Gene Symbol: PHF15
• Gene ID (NCBI): 23338
• RRID: AB_2877772
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQC1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.