PHF17 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PHF17 Polyclonal antibody, PBS Only (28472-1-PBS)

• 

  WB analysis using 28472-1-AP (same clone as 28472-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28472-1-AP (PHF17 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28472-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 28472-1-AP (same clone as 28472-1-PBS)

  WB result of PHF17 antibody (28472-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PHF17 transfected HepG2 cells. This data was developed using the same antibody clone with 28472-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 28472-1-AP (same clone as 28472-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 28472-1-AP (PHF17 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28472-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 28472-1-AP (same clone as 28472-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 28472-1-AP (PHF17 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28472-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 28472-1-AP (same clone as 28472-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PHF17 antibody (28472-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 28472-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PHF17 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 28472-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Jade family PHD finger protein 1, JADE1, PHF 17, Protein Jade-1

---

Product Information

28472-1-PBS targets PHF17 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29675

  Product name: Recombinant human PHF17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 360-450 aa of BC032376

  Sequence: KFKSYCPKHSSHRKPEESLGKGAAQENGAPECSPRNPLEPFASLEQNREEAHRVSVRKQKLQQLEDEFYTFVNLLDVARALRLPEEVVDFL

• Full Name: PHD finger protein 17
• Calculated Molecular Weight: 96 kDa
• Observed Molecular Weight: 65 kDa, 100-110 kDa
• GenBank Accession Number: BC032376
• Gene Symbol: PHF17
• Gene ID (NCBI): 79960
• RRID: AB_2918168
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6IE81
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PHF17, also named as JADE1 and KIAA1807, belongs to the JADE family. PHF17 codes for the Jade-1 protein. This protein interacts with histone acetyltransferase HBO1 and promotes histone acetylation in chromatin to regulate DNA replication and gene transcription. PHF17 is mostly expressed in the small intestine, prostate, mammary gland and kidney. PHF17 is involved in mitosis, meiosis and tumor suppression (PMID: 28134766). PHF17 has 3 isoforms with the molecular mass of 58 kDa and 94-96 kDa. With modification, the MW of PHF17 may be migrated to about 65 kDa and 100-110 kDa.